PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma159g00500.1
Common NameZOSMA_159G00500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 372aa    MW: 42324 Da    PI: 8.6364
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma159g00500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.2e-093143511954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +e+  L++++gLt +q+++WF N R +
  Zosma159g00500.1 314 FEHflHPYPNDNEKLMLSSQTGLTRNQISNWFINARVR 351
                       554458******************************88 PP

2BELL61.81.6e-20183251371
              BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                        e q++++kL++l +e++++Y++y   ++ vi  Fe vag ++ak Y++l  ka+  hF  L++ai  q
  Zosma159g00500.1 183 SERQIRITKLITLSKELERQYEKYLYSMNGVITKFELVAGTDAAKCYINLTIKAMCLHFLKLREAILVQ 251
                       689***************************************************************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.9E-8118250IPR006563POX domain
PfamPF075262.1E-25125248IPR006563POX domain
SMARTSM003898.5E-8295359IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-26300361IPR009057Homeodomain-like
SuperFamilySSF466892.78E-16301362IPR009057Homeodomain-like
PfamPF059204.1E-17312351IPR008422Homeobox KN domain
CDDcd000864.35E-9313356No hitNo description
PROSITE profilePS5007111.337314355IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MVNSEEVGIA FNWIQRNTFP SIDSGCFPAN FESHPPQPQT PWVLLSEEQE QGNGISERVA  60
IDHLIQSNKE NERQRRLGLN LNSNFSSDSL NYKYSNPSPS HSPSQIPISS PPPSHLKTLD  120
LDCFKNSRYL RPAQQLLNEV VCVSDVGSEG NLFSKNASFL GQITDADIWL KCSSPSTNYK  180
DSSERQIRIT KLITLSKELE RQYEKYLYSM NGVITKFELV AGTDAAKCYI NLTIKAMCLH  240
FLKLREAILV QFKKASKSSS PGRIPELSKS CKNVSSQTTS GRNQNLGMIP LRQVWRPLRG  300
LPEKSVVVLR TWLFEHFLHP YPNDNEKLML SSQTGLTRNQ ISNWFINARV RLWKPMIEDM  360
YREEFVDDSN T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14301362566Homeobox protein Meis2
3k2a_B1e-14301362566Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932651.12e-79PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_010932659.12e-79PREDICTED: BEL1-like homeodomain protein 11
TrEMBLA0A0K9PV530.0A0A0K9PV53_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.16e-64BEL1-like homeodomain 11